PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 306aa    MW: 34009.9 Da    PI: 7.7488
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026449genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.37e-4124100278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  C v+gC+adls++++yhrrhkvCe hsk+p+v+v+g+eqrfCqqCsrfh+l efDeekrsCr+rL++hn+rrrk+q+
  DCAR_026449  24 CLVDGCNADLSRCRDYHRRHKVCELHSKTPQVTVRGQEQRFCQQCSRFHSLVEFDEEKRSCRKRLDGHNRRRRKPQS 100
                  **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-331885IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.7612198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-3822103IPR004333Transcription factor, SBP-box
PfamPF031101.5E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MESSPPGSSK KVKALGSMTQ VVSCLVDGCN ADLSRCRDYH RRHKVCELHS KTPQVTVRGQ  60
EQRFCQQCSR FHSLVEFDEE KRSCRKRLDG HNRRRRKPQS ELLHRTSAIY HSDQPAGSTI  120
LSFSNPTKQV PTAGGSSSWI KDVKTEDDTW MSNANLNFIN KPPPGSAAQN YKVPLTCSSN  180
LALETSSFCQ QFLEPDPARG MNQIEFLDRF QMGTSHSCGA PSLLSSEQLE TSVAASSHMV  240
HPNPVHFSLS QSFMQDTHFT GLEQPVVDNL SNNMNNSTLH FGRACDQHGL DLDGSSQHNL  300
SFRLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2724971184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270226.11e-67PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656129.11e-67PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656134.11e-67PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656138.11e-67PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA5BHV41e-67A5BHV4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g03910.t013e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-46SBP family protein